Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g079980.2.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family BES1
Protein Properties Length: 328aa    MW: 34977.2 Da    PI: 8.8938
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g079980.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
              DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspe 91 
                         g+++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc eAGw+ve+DGttyrkg++p+  +e++g+sa+++p+
                         6899************************************************************************.************** PP

              DUF822  92 sslqsslkssalaspvesysaspksssfpspssldsislasa 133
                         ss + s+ ss++asp++sy+ sp+sssfpsps+ d ++++++
                         ***********************************9988755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.2E-6229155IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.131370.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238228.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1
TrEMBLK4BV770.0K4BV77_SOLLC; Uncharacterized protein
STRINGSolyc04g079980.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP37191024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-103BES1 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84